PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G1768
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 386aa    MW: 42487.6 Da    PI: 9.3106
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G1768genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.22.3e-15301349553
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN+ Lk+ l el+
  Gh_A01G1768 301 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKQENTHLKQALVELE 349
                  79****************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-12297358IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.519299351IPR004827Basic-leucine zipper domain
PfamPF001706.0E-12301353IPR004827Basic-leucine zipper domain
CDDcd147074.45E-23301355No hitNo description
Gene3DG3DSA:1.20.5.1703.2E-14301354No hitNo description
SuperFamilySSF579592.56E-10301350No hitNo description
PROSITE patternPS000360304319IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MVVENSEVGE VESTLKEVDQ QLKNHPLSAL GRQSSIYSLT LDEFQHTLCG KNFGSMNMDE  60
FLTSIWNAEE NQATNSINNN HHNNGVNEQV SNHVNLSLNE TASSKGVARQ SSLPRQGSLS  120
LPAPLCRKTV DEVWSEIHKV QQGQGQSNKS NVQNAENTST RQPTFGEMTL EDFLVKAGVV  180
REPCVPPAVP PHSQHQQQFG LHQASNNPAV GYLNDGKGGG GYQPAAAPLS TAIFYNGKVG  240
AAGGYGPGQA MGVVSPISPV SPDGVCTNQV DNAATQFGIE IGGLRGRKRI IDGPIEKVVE  300
RRQRRMIKNR ESAARSRARK QAYTVELEAE LNQLKQENTH LKQALVELER KRKQQYFEEW  360
SMKTQTKAQK AKEKLRVMRR NLSGPL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468185.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X2
SwissprotQ9SJN01e-125ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A0B0P9L60.0A0A0B0P9L6_G
STRINGSolyc09g009490.2.11e-138(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM92012536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-116bZIP family protein